NYMODERNISM

Blogg om vetenskap och kultur

Archive for the month “december, 2007”

Årets flopp

Tja, Nymodernisten kan väl göra som alla andra, fast förhoppningsvis bättre och intressantare: summera året som varit.

Årets flopp är egentligen något av det jävligaste jag varit med om, i alla händelser ett av de största sveken. Men det ledde trots allt till några goda följder som jag inte skulle vilja vara utan (se nästa post, lämpligt döpt till det klämkäcka "Årets flipp").

Det gick sig som så, att eder bloggskribent träffade en snäll — faktiskt mycket snäll — kvinna från Göteborgstrakten. Ganska snart blev det tal om att flytta tillsammans nu i höst. Det spekulerades i att skaffa barn. Allt gick åt helvete.

Det gick åt helvete av en rent löjlig anledning. Ty hennes snällhet nådde en rent himmelskriande nivå. Låt mig förklara.

Fram emot hösten märkte jag att något började hända. Det gick knappt att tala i telefon, alltid var det något annat som behövde fladdras vidare till. Hon ringde inte heller upp när hon lovat att göra det. Det verkade på mig som om det låg något slags nervositet och dåligt samvete i botten. Helt plötsligt var det också fullkomligt omöjligt att träffas när vi kommit överens om det — allt tänkbart och otänkbart lyckades kila sig emellan. Enligt flickvännen.

Efterhand — och först när jag blivit riktigt förbannad — kröp det fram vad allt egentligen handlade om. Den här kvinnan hade helt enkelt inte avslutat med sin förre pojkvän när hon umgicks med mig, och nu klarade hon inte av att bryta med honom. Det var tydligen synd om karln. Och tydligen behövde hon ta mer hänsyn till hans känslor än mina… ironiskt formulerat. Vad hon nu uttryckligen ville var att jag skulle "vänta" tills det gamla förhållandet (förhoppningsvis) ebbade ut. Eller med andra ord: Jag skulle snällt stå bredvid medan förre pojkvännen rullade färdigt i sänghalmen med henne.

Se där hur mesig snällhet kan korrumpera. Det är nästan dråpligt. Men tyck vad man vill, för mig fanns det bara en vettig sak jag kunde göra. Ridå för vårt förhållande.

*  *  *

Vad jag än skrev här, så har den här hösten och vintern varit ganska eländiga för mig. Men lyckligtvis kan saker och ting bara bli bättre när man väl befinner sig på botten. Läs vidare i nästa post.

/ Rickard Berghorn

Annonser

Ett anspråkslöst förslag

[Anm. 2010-01-25: Jag tog bort denna post 2008, som då ännu var märkt med "Under konstruktion", men återpublicerar den nu av skäl som redogörs här. I texten nedan har jag bara ersatt ordet "lägesenergi" med det mer gångbara "potentiell energi" och strukit några onödiga kursiveringar i stycket "Vad är gravitation?". Några övriga småändringar utmärks med klamrar. Publiceringen 2007/2008 borde gå att hitta i t.ex. Googles cashminne.]

Utvecklat en sömnlös natt med Wikipedia i en studentlägenhet i Lund, och sedan diskuterat med Enkla Z över en fika dagen efter.

*

TRÖGHET SOM TERMODYNAMISKT FENOMEN

Massan hos en kropp och dess tröghet står i proportion till varandra, d.v.s. de är på något sätt oupplösligt förbundna med varandra. Ett problem här är dock att fysiker egentligen inte vet vad [..] massa eller tröghet är eller vad det utgörs av — en speciell "massapartikel" har föreslagits men ännu inte observerats (higgsbosonen). Massan står också i proportion till kroppens gravitationskraft och hur den påverkas av andra kroppars gravitation. Trögheten är för övrigt bara kännbar hos en kropp när den tvingas till hastighetsförändringar, och alla sådana hastighetsförändringar — acceleration och inbromsning — är likaså ekvivalenta. Den tröghet ("tyngd" i vardagsspråk) som kan mätas hos en kropp i ett gravitationsfält implicerar att gravitation i sig är en form av accelererande eller inbromsande rörelse.

Massan står dessutom i proportion till den energi som utgör kroppens atomer och elementarpartiklar (kärnkraft, det vill säga E=mc^2). Kort sagt: Massa, kärnenergi, tröghet och gravitation är intimt sammanknutna fenomen, varav trögheten bara ger sig tillkänna när kroppen inte befinner sig i fritt fall.

Mitt anspråkslösa förslag: Av termodynamiska skäl överförs inte den rörelseenergi som används för att accelerera en kropp till likvärdig energi hos kroppen; rörelseenergin omvandlas också till andra energiformer. En viss del av den energin kan övergå till, säg, friktion och lämna kroppen som strålning, medan den övriga energin lär bli kvar i kroppen, t.ex. i form av olika sorters potentiell energi . Med andra ord skulle det inte vara trögheten som orsakar energiåtgången när till exempel en rymdfärja startar motorerna för att accelerera, utan tvärtom: omvandlingen av rörelseenergin till andra energiformer orsakar upplevelsen av tröghet.

Därav kan man möjligen göra en snygg och begriplig helhet av massa, tröghet och kärnenergi. Dessutom antyds en koppling till kvantmekaniska fenomen. Bryggan mellan kvantmekaniken och relativitetsteorin skulle kort sagt kunna vara termodynamiska processer.

Förtydligande. Tag den så kallade tvillingparadoxen (som nu inte är någon paradox, men populärt kallas det). Vi har två identiska klockor. Den ena skickas ut på en långfärd i universum nära ljushastigheten, vilket enbart kan åstadkommas genom acceleration och inbromsning — fenomen som alltså är ekvivalenta. När den kommer hem igen, visar de båda klockorna inte samma tid. Långfärdsklockan har inte åldrats lika mycket som den hemmavarande.

Man kan korrekt påstå att långfärdsklockan befinner sig på en högre energinivå än den andra; dess entropi är helt enkelt lägre. Enligt mitt förslag på grund av energin som tillförts genom accelerationen. Det är uppenbarligen också en fråga om potentiell energi. När man bär upp (eller "accelererar") en sten till en bergstopp ["laddas" den med] potentiell energi, som sedan frigörs tillbaka till rörelseenergi när den faller ner igen. Klockan här har utsatts för acceleration och förts upp eller snarare hållits kvar på en högre [energinivå], till skillnad från den andra klockan som enbart har "fallit".

*

VAD ÄR TID?

Tid är, liksom tröghet, inte något som relativitetsteorin förklarar, den tas bara som utgångspunkt — ett givet fundament om man så vill. Inom termodynamiken finns dock något som kan användas som förklaring: irreversibla processer. Det är, enkelt uttryckt, bara mer sannolikt att fysikaliska processer rör sig i en viss riktning och inte den motsatta, eller i helt nyckfulla riktningar. En kaffekopp faller ner och krossas mot golvet. Det omvända — att de utspridda bitarna spontant skulle samla ihop sig och koppen lika spontant hoppa upp på bordet igen — kan hända. Men det är också obefintligt osannolikt.

Tid kan alltså betraktas som en fråga om ren sannolikhet, ett statistiskt fenomen. På universums lägsta nivå, i kvantvärlden, kan man säga att det bara finns förändring, men inte tillräckligt många "enheter" som kan ge ett uppenbart, om än statistiskt, tidsbegrepp. Därav alla vardagsfrämmande kvantfenomen, som till exempel upphävandet av kausalitetsprincipen.

För att vända eller i alla fall skjuta upp en irreversibel process behövs alltid ett tillskott av energi. Detta tillskott har ena klockan i exemplet fått genom accelerationen, medan den andra blivit utan.

*

VAD ÄR RUM?

Om nu tiden "bara" är ett statistiskt fenomen, hur gör man då med de andra rumtidsdimensionerna? Längd, bredd och djup kan på samma sätt ses som statistiska egenskaper — och varför inte? Om kvantfenomen kan anses ske utan tid eller tidsriktning (vilka kan betraktas som en och samma sak, en definitionsfråga), borde det också vara möjligt att beskriva kvantvärlden som dimensionslös. De enklaste partiklarna har inget "intresse&quot
; av diverse rums- och tidsdimensioner utan rör sig och existerar obehindrat av dem, men sammantaget ger de upphov till vår rumtid.

Jämför här med utvecklingen av den klassiska kvantmekaniken, kvantelektrodynamiken, som gav Richard Feynman et al Nobelpriset 1965. Alla fenomen och skeenden som uppträder i [kvantfysiken] kan betraktas som det statistiska medelvärdet av alla de möjliga sätt som dessa kan uppträda på, och i en mening också gör. Eller som Feynman skriver i boken QED: The Strange Theory of Light and Matter:

Throughout these lectures I have delighted in showing you that the price of gaining such an accurate theory has been the erosion of our common sense. We must accept some very bizarre behavior: the amplification and suppression of probabilities, light reflecting from all parts of a mirror, light travelling in paths other than a straight line, photons going faster or slower than the conventional speed of light, electrons going backwards in time, photons suddenly disintegrating into a positron-electron pair, and so on. That we must do, in order to appreciate what Nature is really doing underneath nearly all the phenomena we see in the world.

*

VAD ÄR GRAVITATION?

Som nämnts tidigare är alla hastighetsförändringar hos en kropp ekvivalenta. Acceleration och inbromsning är i grunden exakt samma fenomen. Upplevelsen av tyngd (bara ett annat ord för tröghet) i ett gravitationsfält kan inte heller särskiljas från en accelererande eller inbromsande rörelse. Hur svårt vi än har att likställa dessa fenomen, eftersom vi är så vana vid att tala om dem i olika sammanhang, gör naturen i sig inte någon skillnad på dem.

Ifall tröghet är ett termodynamiskt fenomen, blir hastighetsförändringar i [..] grundläggande mening en fråga om energiförändringar. Den våldsamma energiutvecklingen som sker initialt när två asteroider i tomma rymden kolliderar och förenas till en större, kommer efterhand att lugna ner sig, och det totala resultatet av kollisionen blir högre entropi (lägre energinivå). Med andra ord, det som sker vi denna process handlar om strävan efter termisk jämvikt. Termisk jämvikt blir här också jämställt med fritt fall, eftersom den nya asteroiden återgår till det tillståndet.

Men uppenbarligen handlar detta fria fall bara om totalsumman av kroppens termiska tillstånd. Det totala resultatet av kollisionen definierar den nya hastigheten, riktningen och energiinnehållet. Men det betyder inte att varje enskild del av asteroiden måste befinna sig i termisk jämvikt med andra delar av samma kropp. Här förekommer alltid ett visst mått av termiska processer och ökande entropi, varav en av de mest fundamentala är radioaktivt sönderfall. "Konflikten" när de båda asteroiderna kolliderade var relativt snabbt löst med generell jämvikt som resultat, men myriader av andra termiska "konflikter" — både sådana som initierades och inte initierades av kollisionen — utspelar sig fortlöpande bland de gaser, stenar, kristaller, molekyler och atomer som den nya asteroiden består av.

Ju större en kropp blir, desto högre och mer instabil tenderar dess energinivå att vara; och desto mer intensiva blir de termodynamiska processerna. Hos en liten asteroid är de knappt märkbara, till skillnad från den våldsamma energiomvandlingen hos solen och andra stjärnor.

Detta fria fall + sjunkande energinivå (växande entropi), borde motsvara gravitationen. Skillnaderna i attraktion/gravitationskraft kommer naturligtvis av att en större kropp befinner sig på en högre energinivå än mindre kroppar.

Relativitetsteorins rumtidsstruktur som kröks runt fasta kroppar och ger upphov till gravitationsfälten, skulle i en termodynamisk beskrivning motsvara olika energinivåer.

Förtydligande. En termodynamisk process resulterar alltid i högre entropi än vid initialtillståndet, liksom i exemplet med de två kolliderande asteroiderna. Det är i princip ingen skillnad mellan asteroidexemplet och det som sker när en fritt fallande kropp möter Jordens yta; det totala resultatet av "processen" blir högre entropi. Det är bara proportionerna som skiljer i och med att den fallande kroppen är mycket mindre än jordklotet. Av den anledningen blir också processen mot termisk jämvikt mer segdragen. Den fallande kroppen kan inte lika gärna studsa ut i rymden igen och behålla mycket av sin rörelse- och lägesenergi, utan får finna andra vägar i sin strävan mot lägsta möjliga energinivå. Därav upplevelsen av tyngd och gravitationskraft. Tyngden i gravitationsfältet är alltså detsamma som kroppens tröghet, när rörelseenergin övergår till andra energiformer. Se avsnittet "Tröghet som termodynamiskt fenomen".

Den som kan sin termodynamik förstår också att detta — ständigt ökande entropi som resultat av kroppars interagerande — inte motsäger principen att en liten astronomisk kropp kan samla på sig så mycket materia att den till slut når lika hög och instabil energinivå som till exempel solen. Även om molekyler och materia har samlats in och packats ihop till ett högenergetiskt plasmaklot, har ändå mer energi gått åt till processen än vad som "förpackats". Alltså kommer mindre kroppar alltid att attraheras av större, av den enda anledningen att det totala resultatet blir högre entropi.

*  *  *

Tillägg: Relativistisk termodynamik existerar men befinner sig ännu i sin linda. Betydligt längre har man nått med att kombinera termodynamik och kvantmekanik. Det är talande att "relativistic thermodynamics" inte ens finns som uppslagsord i engelska Wikipedia.

ANDRA BLOGGAR OM: VETENSKAPFILOSOFIFYSIKRELATIVITETSTEORINTERMODYNAMIKKVANTFYSIKKVANTMEKANIKKOSMOLOGIENTROPISPEKULATIONER

/ Rickard Berghorn 

Post Navigation